Total number of results for Pyxicephalus adspersus are 1
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02281 |
HAEGTFTSDMTSYLEEKAAKEFVDWLIKGRPK
|
32 | Pyxicephalus adspersus | Glucagon | Glucagon-like peptide 1 | 10882553#Conlon JM, White AM, Platz JE#Islet hormones from the African bullfrog Pyxicephalus adspersus (Anura:Ranidae): structural characterization and phylogenetic implications#Gen Comp Endocrinol 2000 Jul;119(1):85-94 |